Protein Info for CSW01_03625 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00072: Response_reg" amino acids 5 to 112 (108 residues), 85.9 bits, see alignment E=2.2e-28 PF04397: LytTR" amino acids 142 to 234 (93 residues), 92.8 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 100% identical to Y693_VIBCH: Uncharacterized response regulatory protein VC_0693 (VC_0693) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 100% identity to vcm:VCM66_0651)

Predicted SEED Role

"FIG001014_Response regulator of the LytR/AlgR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>CSW01_03625 DNA-binding response regulator (Vibrio cholerae E7946 ATCC 55056)
MLSALLIDDERFAREELAELLAESGQIEVIGQASNAIEGLKKINQLKPDVVFLDIQMPQI
SGIELLSMLDPETMPEVVFVTAYDQYALQAFEDNAFDYLLKPVDTERLAKTVQRLLRQHK
KSDYSPLTQPSLDQIPCTGLNRIVLLPINEVEFAYSDISGVNVQTAQQKATSQLTLKVLE
EKTALVRCHRQYLVNLKAIREIKLLENGLAEMITHAGHKVPVSRRYLKELKEMLGFY