Protein Info for CSW01_03610 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR00274: N-acetylmuramic acid 6-phosphate etherase" amino acids 13 to 303 (291 residues), 438 bits, see alignment E=6.7e-136 PF13580: SIS_2" amino acids 53 to 172 (120 residues), 41.5 bits, see alignment E=3.4e-14 PF22198: GKRP_SIS_2" amino acids 54 to 117 (64 residues), 32 bits, see alignment E=2.6e-11 PF22645: GKRP_SIS_N" amino acids 54 to 161 (108 residues), 82.1 bits, see alignment E=6.3e-27 PF01380: SIS" amino acids 137 to 217 (81 residues), 35.2 bits, see alignment E=2.5e-12 PF20741: GKRP-like_C" amino acids 228 to 271 (44 residues), 32.3 bits, see alignment 3e-11

Best Hits

Swiss-Prot: 100% identical to MURQ2_VIBCH: N-acetylmuramic acid 6-phosphate etherase 2 (murQ2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 100% identity to vcm:VCM66_0648)

MetaCyc: 55% identical to N-acetylmuramic acid 6-phosphate etherase (Escherichia coli K-12 substr. MG1655)
RXN0-4641 [EC: 4.2.1.126]

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-, 4.2.1.126

Use Curated BLAST to search for 4.2.-.- or 4.2.1.126

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>CSW01_03610 N-acetylmuramic acid 6-phosphate etherase (Vibrio cholerae E7946 ATCC 55056)
MTNDALIAALSHLVSEGRNPDTMDIDLLSSQEIVERLNQQDKQVPLAVEAVLPQIAQAVD
KITAAFKQGGRLIYLGAGTSGRLGVLDASECPPTFGVSDQMVIGLIAGGKEAMFTAQEGA
EDNATLGAHDLQQIDFSSKDVLVGIAASGRTPYVIGALEYANDLGATTIALSCNPDSPIA
EIAQIAISPVVGPEALTGSTRLKSGTAQKLVLNMLTTASMIRLGKSYQNLMVDVRATNRK
LIARAVRIVMQATDCQREEAEALLKESHNNAKLAILMHLTGMNYEQATAKLSQSDGFLRR
AMEEHEE