Protein Info for CSW01_03560 in Vibrio cholerae E7946 ATCC 55056

Annotation: 30S ribosomal protein S20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details TIGR00029: ribosomal protein bS20" amino acids 1 to 85 (85 residues), 106.6 bits, see alignment E=3.7e-35 PF01649: Ribosomal_S20p" amino acids 2 to 84 (83 residues), 104.9 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 100% identical to RS20_VIBC3: 30S ribosomal protein S20 (rpsT) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K02968, small subunit ribosomal protein S20 (inferred from 99% identity to vcj:VCD_003641)

MetaCyc: 71% identical to 30S ribosomal subunit protein S20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S20p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (86 amino acids)

>CSW01_03560 30S ribosomal protein S20 (Vibrio cholerae E7946 ATCC 55056)
MANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIAAGDKEAATAAFAVVTPILDR
MATKGLIHKNKAARHKSRFFAAINAL