Protein Info for CSW01_03550 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcriptional activator protein NhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00126: HTH_1" amino acids 7 to 65 (59 residues), 62.1 bits, see alignment E=3.8e-21 PF03466: LysR_substrate" amino acids 97 to 288 (192 residues), 46.8 bits, see alignment E=2.4e-16

Best Hits

Swiss-Prot: 100% identical to NHAR_VIBCH: Transcriptional activator protein NhaR (nhaR) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03717, LysR family transcriptional regulator, transcriptional activator of nhaA (inferred from 100% identity to vco:VC0395_A0209)

Predicted SEED Role

"Transcriptional activator NhaR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>CSW01_03550 transcriptional activator protein NhaR (Vibrio cholerae E7946 ATCC 55056)
MSHLNYNHLYYFWMVCKQGSVTKAADALFLTPQTVTGQIKALEDRLDGKLTKRNGRSIEP
TELGQLVFKYADRMFGLSYEMLDIVNYSQRSNLLFDVGVADALSKRLVSKILLTSVPGDN
RIHLRCFESTHEMLLEQLAQHKLDMILSDCPVDSSQSPGLFSKKLGESRMSFFSFGDVDF
APFPAVLQSKKLLVPGSRTAMGRKVRQWFDRQGLQPHILGEFDDSALMKAFAIYHSDAVF
MAPSFYVSEVDAESSLKLIGHVDEIKEEYYVIFAERMIQHPAVKNVCDADFTNLFL