Protein Info for CSW01_03545 in Vibrio cholerae E7946 ATCC 55056

Annotation: Na/Pi cotransporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 61 to 89 (29 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 314 to 340 (27 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 30 to 132 (103 residues), 72.2 bits, see alignment E=2.3e-24 amino acids 218 to 326 (109 residues), 64.8 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K14683, solute carrier family 34 (sodium-dependent phosphate cotransporter) (inferred from 100% identity to vcj:VCD_003645)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>CSW01_03545 Na/Pi cotransporter family protein (Vibrio cholerae E7946 ATCC 55056)
MINQATSPAAPISLTTKGLRWANLAFMLYLLLLAVAMVGSGFKWATGDQAKVLFEFASHP
IAGLMIGLVATALIQSSSTVTSIIVGLVAGGLPVETAIPMVMGANIGTTVTNTLVSLGHM
RCKEEFRRAFASATIHDFFNLLAVLIFLPLEMMFGILEKVSHWLVSPLLATGDMSMKGFD
FIKPITKPVITGLETQLSVLGNTFGGVALIVLGIATIFVAITVMGKLMKSLMVGRAREIL
QNAIGRGPLHGIASGTVVTVLVQSSSTTTSLMVPLVGSGVLKVREIYPFTLGANIGTCIT
ALLAATAVSGEFAVFALQIALVHLSFNLMATVLIYGIPFLRELPIKGAELISTWACKSKM
VVVSYLLGVFVVIPGSILALTA