Protein Info for CSW01_03520 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 28 to 153 (126 residues), 89.4 bits, E=1.1e-29

Best Hits

Swiss-Prot: 99% identical to RPPH_VIBCH: RNA pyrophosphohydrolase (rppH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 100% identity to vcj:VCD_003650)

MetaCyc: 74% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (193 amino acids)

>CSW01_03520 RNA pyrophosphohydrolase (Vibrio cholerae E7946 ATCC 55056)
MLRLGICGKINAIKEFTRGLPVIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGG
IDDGESPEQAMFRELYEEVGLTKKDVKVIATSRHWLRYKLPKRLVRWDSQPVCIGQKQKW
FLLRLECDESKINMQRGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFK
ERKVKGKRNTHRG