Protein Info for CSW01_03515 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA mismatch repair protein MutH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02248: DNA mismatch repair endonuclease MutH
  • amino acids 5 to 219 (215 residues), 330.7 bits, E=1.4e-103
• PF02976: MutH
  • amino acids 53 to 151 (99 residues), 124 bits, E=1.1e-40

Best Hits

Swiss-Prot: 100% identical to MUTH_VIBCM: DNA mismatch repair protein MutH (mutH) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03573, DNA mismatch repair protein MutH (inferred from 100% identity to vcj:VCD_003651)

MetaCyc: 63% identical to DNA mismatch repair protein MutH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair endonuclease MutH" in subsystem DNA repair, bacterial

Protein Sequence (221 amino acids)

>CSW01_03515 DNA mismatch repair protein MutH (Vibrio cholerae E7946 ATCC 55056)
MKPAPTTQQELLTRAQQIAGLSFAELADEAGMTVPPDLRKDKGWVGQLLEWHLGATAGSR
PQQDFEHLGIELKSIPISYTGKPLETTFVCVAPLTGVHGLTWEQSHVRNKLSKVLWIPVQ
GEREIPLAERCVGSPLLWSPSPEEEAQLKADWEELMEWIVLGKVAQITAKHGEVLQLRPK
AANGRALTEAYGANGRPIKALPRGFYLRTQFTAQILQRYYA