Protein Info for CSW01_03460 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosomal-protein-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 24 to 156 (133 residues), 130.3 bits, E=2.5e-42
• PF00583: Acetyltransf_1
  • amino acids 26 to 133 (108 residues), 60.8 bits, E=3.9e-20
• PF13302: Acetyltransf_3
  • amino acids 39 to 134 (96 residues), 28 bits, E=8e-10
• PF13673: Acetyltransf_10
  • amino acids 42 to 139 (98 residues), 42.5 bits, E=1.6e-14
• PF13508: Acetyltransf_7
  • amino acids 57 to 134 (78 residues), 46.5 bits, E=1e-15
• PF08445: FR47
  • amino acids 79 to 139 (61 residues), 29.9 bits, E=1.1e-10

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to vch:VC0657)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Protein Sequence (161 amino acids)

>CSW01_03460 ribosomal-protein-alanine N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MAANLRSSRNRIMTTVFTAMQPTHLDAVWRIECAAHSHPWAESLVRDLTSRGACHQVMLV
DQQVVGYFYAQNIVGEVTLLNIAIDPAQQGKGYGQQLLQHFIALCEQQKAESAWLEVRES
NQRAFALYQRAGFNEIDRRVNYYPVAKGKSEDAIIMSYLFL