Protein Info for CSW01_03450 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF13527: Acetyltransf_9" amino acids 25 to 139 (115 residues), 39.1 bits, see alignment E=1.4e-13 PF00583: Acetyltransf_1" amino acids 51 to 138 (88 residues), 39.2 bits, see alignment E=1.6e-13 PF13673: Acetyltransf_10" amino acids 54 to 138 (85 residues), 25.1 bits, see alignment E=3.1e-09 PF13508: Acetyltransf_7" amino acids 60 to 139 (80 residues), 40.7 bits, see alignment E=5e-14

Best Hits

Swiss-Prot: 56% identical to YHBS_ECOL6: Uncharacterized N-acetyltransferase YhbS (yhbS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03824, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to vcj:VCD_003756)

Predicted SEED Role

"FIG002208: Acetyltransferase (EC 2.3.1.-)" in subsystem CBSS-214092.1.peg.3450 (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>CSW01_03450 N-acetyltransferase (Vibrio cholerae E7946 ATCC 55056)
MCIKGCKRRIHPTRLLMLIRTEAPADILVVDQLLKNVFATEAEADLVMALRENGQRTLSL
VACDDEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELG
YPACVVLGDPAYYSRFGFEDAARYSLRCAWDVPQGAFQVVALWERELDGRCGVIEYSQEF
AAL