Protein Info for CSW01_03440 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 TIGR00229: PAS domain S-box protein" amino acids 11 to 123 (113 residues), 32.1 bits, see alignment E=1.1e-11 PF08448: PAS_4" amino acids 18 to 122 (105 residues), 31.3 bits, see alignment E=6.2e-11 PF13426: PAS_9" amino acids 24 to 115 (92 residues), 14.5 bits, see alignment E=1.1e-05 amino acids 144 to 189 (46 residues), 24.2 bits, see alignment 1e-08 PF13188: PAS_8" amino acids 135 to 182 (48 residues), 24 bits, see alignment 8.7e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 254 to 410 (157 residues), 130.1 bits, see alignment E=6.8e-42 PF00990: GGDEF" amino acids 256 to 409 (154 residues), 147.1 bits, see alignment E=1.2e-46 PF00563: EAL" amino acids 430 to 664 (235 residues), 248.5 bits, see alignment E=1.8e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC0653)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>CSW01_03440 bifunctional diguanylate cyclase/phosphodiesterase (Vibrio cholerae E7946 ATCC 55056)
MPAQTSSQLKHWFAKITSHSPFFFAILNDQHQYVMVNERYCDIAGLSSEEMVGMSDSQVL
GEHFYRHLKPFYERAFNNEHIESELTLSEIDLETSLHFSLSPIMINDRVQYLVFHAIDTS
EKQILVRSLEESESKYALLTTLLPDGLMMVENDCIISANPSAARLLGFDDAQKLLGENLS
RLFIDEKTKTVFSSQLASLLTEKPLVCLTGPRCGFERKIQLHAGCTSLLGNQSQLILLQD
ADEAPKQFSATTQVDAHIDSLTGLYNRHGFTKRLEQCIQNETPLVMLYLDIDNFKNINDS
LGHHIGDKVIKEVAARLKRLLPQQAVLGHLGGDEFGLILPEPEHNRSAEMLADRIISLIN
QPFDLHHFSKRLACSIGSVRYPGDGNDARVLLQNADTAMYEAKERGRNRLIKFNDQMNKE
ARMRLWLEIELQKALQQNGLEVWYQPKVNARDFSINGAEALVRWKHPVEGYISPGAFIPV
AEKAGLIEHLGRVVMREVFATVKRWKLQGILPGRVAINISPEQFGNPQLIDYLEKLLRTT
GLDPNNITFELTESAVMSDSEHTQQMLNAIKKLGFTLSIDDFGTGYSSLAYLARFPIDEL
KIDRAFISNIDTLPKQLTVIENIINLGRSLNLTVVAEGVETQQQATLLSNLNCHSIQGFH
FYRPQPKHEVEELFAQNRRHRKSL