Protein Info for CSW01_03330 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03449: GreA_GreB_N
  • amino acids 4 to 73 (70 residues), 88.5 bits, E=2.6e-29
• TIGR01462: transcription elongation factor GreA
  • amino acids 5 to 154 (150 residues), 176.5 bits, E=1.8e-56
• PF01272: GreA_GreB
  • amino acids 81 to 156 (76 residues), 94.6 bits, E=2.7e-31

Best Hits

Swiss-Prot: 100% identical to GREA_VIBCH: Transcription elongation factor GreA (greA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 100% identity to vco:VC0395_A0163)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Protein Sequence (157 amino acids)

>CSW01_03330 transcription elongation factor GreA (Vibrio cholerae E7946 ATCC 55056)
MEKVPMTARGEKLLREELDRLLKLRPKITEAIAEARELGDLKENAEYHAAREEQGICEAQ
IRDIEYKLSVAQVIDVTKMENSGKVIFGATVTVIDVNSDEEKTYQIVGDDEADIKSGRIS
VNSPIARGLIGKFEGDEVSIATPGGNKVFEIDRVEYL