Protein Info for CSW01_03325 in Vibrio cholerae E7946 ATCC 55056

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13609: Porin_4" amino acids 18 to 326 (309 residues), 103.7 bits, see alignment E=1.7e-33 PF00267: Porin_1" amino acids 61 to 350 (290 residues), 58.6 bits, see alignment E=7.5e-20

Best Hits

Swiss-Prot: 100% identical to OMPU_VIBCH: Outer membrane protein U (ompU) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K08720, outer membrane protein OmpU (inferred from 100% identity to vcm:VCM66_0591)

Predicted SEED Role

"Outer membrane protein OmpU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>CSW01_03325 porin (Vibrio cholerae E7946 ATCC 55056)
MDNKLGLNKMNKTLIALAVSAAAVATGAYADGINQSGDKAGSTVYSAKGTSLEVGGRAEA
RLSLKDGKAQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQGKNASNNSLDNRYTYA
GIGGTYGEVTYGKNDGALGVITDFTDIMSYHGNTAAEKIAVADRVDNMLAYKGQFGDLGV
KASYRFADRNAVDAMGNVVTETNAAKYSDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQ
NEYMLAASYRMENLYFAGLFTDGELAKDVDYTGYELAAGYKLGQAAFTATYNNAETAKET
SADNFAIDATYYFKPNFRSYISYQFNLLDSDKVGKVASEDELAIGLRYDF