Protein Info for CSW01_03315 in Vibrio cholerae E7946 ATCC 55056

Annotation: Tyrosine--tRNA ligase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR00234: tyrosine--tRNA ligase" amino acids 4 to 395 (392 residues), 430.3 bits, see alignment E=4e-133 PF00579: tRNA-synt_1b" amino acids 30 to 317 (288 residues), 289.7 bits, see alignment E=2.7e-90 PF01479: S4" amino acids 338 to 372 (35 residues), 24 bits, see alignment 2.6e-09

Best Hits

Swiss-Prot: 100% identical to SYY2_VIBCH: Tyrosine--tRNA ligase 2 (tyrS2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to vch:VC0631)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.1

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>CSW01_03315 Tyrosine--tRNA ligase 2 (Vibrio cholerae E7946 ATCC 55056)
MASIEAALAEIKRGVEELIPEEELIAKLKENRPLRIKLGADPTAPDIHLGHTVILNKLRT
FQDLGHDVTFLIGDFTGMVGDPTGKNTTRPPLTREDVLRNAETYKQQVFKILDPAKTKIQ
FNSEWLSKLGAEGMIRLASNQTVARMLERDDFKKRYNNGQPIAIHEFMYPLLQGYDSVAM
ETDVELGGTDQKFNLLMGRELQKANGQKPQVVLMMPLLVGLDGEKKMSKSAHNYIGVSEA
PSEMFGKIMSISDDLMWSYYELLSFRPLEEVAQFKAEVANGANPRDIKILLAKEIIARFH
SQADADAAEQEFINRFQKGAMPEEMPEFEFESGIAISNLLKEAGLVASTSDALRMIKQGA
VKLDGEKLEDAKLIPACGTSVYQVGKRKFARVTIK