Protein Info for CSW01_03280 in Vibrio cholerae E7946 ATCC 55056

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF08468: MTS_N" amino acids 8 to 163 (156 residues), 191.5 bits, see alignment E=2.1e-60 PF05175: MTS" amino acids 171 to 336 (166 residues), 198.9 bits, see alignment E=9.1e-63 PF06325: PrmA" amino acids 199 to 272 (74 residues), 24.5 bits, see alignment E=3.7e-09

Best Hits

Swiss-Prot: 100% identical to RSMC_VIBC3: Ribosomal RNA small subunit methyltransferase C (rsmC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to vch:VC0623)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>CSW01_03280 16S rRNA methyltransferase (Vibrio cholerae E7946 ATCC 55056)
MQPYTAPSEIALRQLDYFADKHVLVAGEVEDRFPIELRQYCASVSVFTTHYGYYSQLKAY
PEITRYFGEQLTADLNADLILLYWPKAKQEAEYLLAMLLAKLGTGTEIVVVGENRSGVKS
IEKMFAAYGPIHKYDSARRCSFYWGHCVHTPAAFDIEQWFKSYAVDYQGHELTIRSLPGV
FSHGEFDLGSRLLLDTLPPLSGKVIDIGSGAGVLGCVMAKLNPHIELEMTDISALAIRSS
QETLVANQLHGHVYPSDMFSDTGHHYNYIVTNPPFHSGLETSYSATERLLAESVDHLASG
GSIWVVANSFLKYPPILEQAFGHCDIAAKTNKFAIYHAKK