Protein Info for CSW01_03205 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 34 to 282 (249 residues), 62.7 bits, see alignment E=1.2e-20 PF13531: SBP_bac_11" amino acids 35 to 284 (250 residues), 50.4 bits, see alignment E=5.2e-17 PF13416: SBP_bac_8" amino acids 39 to 311 (273 residues), 56.4 bits, see alignment E=8.7e-19 PF13343: SBP_bac_6" amino acids 73 to 299 (227 residues), 59.9 bits, see alignment E=5.6e-20

Best Hits

Swiss-Prot: 38% identical to FUTA2_SYNY3: Iron uptake protein A2 (futA2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to vch:VC0608)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>CSW01_03205 iron ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MKKLLSLSAITLSVLAPSAFAAQEVNVYSYRQPFLIEPMFAEFTKETGIKVNVKFAKEGI
AEKLAQEGEYSPADVILTSEFSRLFELTEKGLTQPLDSKVIEENIPAQYRDSGDEWFALT
QRTRSVYSSRDRLGKLGDDFDYMDLAKPEFKGKICTRSGKHPYNIALVASIIANHGEAEA
KAWLEGVKANLARKPQGNDRDQVRAIKEGLCDVSLGNSYYLGAMLNDQEQKSWAEAVYIN
FPGQNVQGTHVNVSGMAMAKYSPNRENAQKLMEFLTGETAQKMYAEVNYEYPVKPGVQRS
ALVESWGEFKADSLPLEKIADNNAAAIKLIDEVKFDL