Protein Info for CSW01_03145 in Vibrio cholerae E7946 ATCC 55056

Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01942: poly(A) polymerase" amino acids 21 to 452 (432 residues), 525.7 bits, see alignment E=4.1e-162 PF01743: PolyA_pol" amino acids 52 to 183 (132 residues), 134.7 bits, see alignment E=3.5e-43 PF12627: PolyA_pol_RNAbd" amino acids 210 to 271 (62 residues), 73.1 bits, see alignment E=1.9e-24 PF12626: PolyA_pol_arg_C" amino acids 329 to 448 (120 residues), 126.5 bits, see alignment E=8.3e-41

Best Hits

Swiss-Prot: 57% identical to PCNB_ECOL6: Poly(A) polymerase I (pcnB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to vco:VC0395_A0125)

MetaCyc: 57% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>CSW01_03145 polynucleotide adenylyltransferase PcnB (Vibrio cholerae E7946 ATCC 55056)
MNNNDFEPSNTRTYPDLALTIIPRQEHPISRQQISENALKVLYRLHGAGFEAFLVGGGVR
DLLLGGKPKDFDVATNATPEQLRQLFRNCRLIGRRFRLAHIMFGRDIVEVATFRGHHQES
SQSQNIAAQSEAGMLLRDNVYGTIDEDAERRDFTINAMYYNIADYSIHDYAGGMEDLEDR
LVRLIGDPETRYREDPVRMLRAVRFAVKLDFDIEEDTAAPIEQLAPLLRDIPAARLYEES
LKMLQAGHGLETYHLMRQYNLFQQLFPTIAEHFTADHSSKTEQMLDLVLDATDIRVEEDL
RINPAFMFAAMLWYPMIDLADRLMESLDLNEFDAITEASNRILDEVVKRIAIPRRHTTTV
RDIWQLQQRLPRRSGKRAFRLLELNKFRAGFDFLEMRGEIEGGETKQLAEWWATFQSAGR
NMRQAMVGDIGNATGSSKSGARRRKPSRNKSKSKSSE