Protein Info for CSW01_03130 in Vibrio cholerae E7946 ATCC 55056

Annotation: pantoate--beta-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR00018: pantoate--beta-alanine ligase" amino acids 1 to 281 (281 residues), 354.7 bits, see alignment E=2.8e-110 PF02569: Pantoate_ligase" amino acids 2 to 278 (277 residues), 346.1 bits, see alignment E=6e-108 TIGR00125: cytidyltransferase-like domain" amino acids 23 to 68 (46 residues), 37.7 bits, see alignment 1.9e-13

Best Hits

Swiss-Prot: 100% identical to PANC_VIBC3: Pantothenate synthetase (panC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 100% identity to vch:VC0591)

MetaCyc: 58% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>CSW01_03130 pantoate--beta-alanine ligase (Vibrio cholerae E7946 ATCC 55056)
MQVFADIAVLREQIKQIKREGRRVAFVPTMGNLHEGHLTLVRKARELADVVVVSIFVNPM
QFDRAEDLKNYPRTLEEDLSKLNGEGVDLVLTPTPETMYPQGLDKQTFVEVPGLSYMLEG
ASRPGHFRGVATIVTKLFNIVQPDVACFGEKDFQQLAVIRQMVEDLCMDIEIVGVATVRE
LDGLAMSSRNNLLTLDERQRAPVLARTMRWISSAIRGGRDDYPSIIEDAVDQLRAADLEP
DEIFIRDARTLLPISSESKQAVILMSAFLGKVRLIDNQVLDLQTDTKASSEEE