Protein Info for CSW01_03125 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 103 to 132 (30 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details PF01061: ABC2_membrane" amino acids 8 to 218 (211 residues), 139.1 bits, see alignment E=1.6e-44 PF12698: ABC2_membrane_3" amino acids 57 to 244 (188 residues), 42.7 bits, see alignment E=4.1e-15

Best Hits

Swiss-Prot: 70% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to vco:VC0395_A0121)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>CSW01_03125 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MYQIYWTAFCSLLGKEINRFTRIWVQTLVPPAITMTLYFIIFGNLIGSRIGQMNGFSYME
YIVPGLIMMSVITNSYSNVASSFFSSKFQKNIEELLVAPVPNYVIIAGYVMGGVARGLLV
GAMVTAVSLLFVDLQVDHWGIIIATVFLTSVVFSLGGLINAVFAKTFDDISIVPTFVLTP
LTYLGGVFYSISLLPEFWQSVSKINPIVYMVNAFRYGFLGVSDVDIMTSFAVLMAFVVAL
YCVAHYLVTKGKGLRS