Protein Info for CSW01_03115 in Vibrio cholerae E7946 ATCC 55056

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 373 to 402 (30 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details PF00916: Sulfate_transp" amino acids 11 to 376 (366 residues), 302.2 bits, see alignment E=4.7e-94 PF01740: STAS" amino acids 438 to 530 (93 residues), 46.1 bits, see alignment E=3.6e-16

Best Hits

Swiss-Prot: 58% identical to BICA_SYNP2: Bicarbonate transporter BicA (bicA) from Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to vcm:VCM66_0545)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>CSW01_03115 SulP family inorganic anion transporter (Vibrio cholerae E7946 ATCC 55056)
MFQARFADLNLRCDLFGGVTTAIISLPLALAFGVASGAGAEAGLWGAILVGFFAALFGGS
STLISEPTGPMTVIMTAILTAMVARYPESGAAIAFTVVMMAGAFQILLGTLKLGKYITLM
PYSVVSGFMSGIGVILIILQLSPLLGHPSPGGGVLGTLSALPDLLANLKFSELFLGLLTL
GILFFLPQKYRKQVPAQLVALVVVTLFSVIFFDTDDIRRIGEIPAGLPSIVVPTFTGDIV
VTMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDRELQGQGIANMVAGLFGALPGAGA
TMGTVTNIQVGARSPLSGVTRALMLALVVLVAGGLTEPIPMAVLAGIAVYVGVNILDWAF
IQRAHKISLQGMAIMYGVMLLTVFVDLIVAVGLGVFISNILVIERLSREQARQVKAISDA
DDDDVPLTESERKLLDKANGKVLFFYLSGPMIFSVSKAITRQHSSVDQYQAMILDLTDVP
MIDVTVGLALENAIRDAQEAHCEVYLLCPNEKTRAELEKFKVIDLVPDQNMFTFRYEALN
AAVKQVNT