Protein Info for CSW01_03060 in Vibrio cholerae E7946 ATCC 55056

Annotation: stringent starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF02798: GST_N" amino acids 10 to 81 (72 residues), 58.5 bits, see alignment E=1.7e-19 PF13417: GST_N_3" amino acids 20 to 87 (68 residues), 58.2 bits, see alignment E=2.1e-19 PF13409: GST_N_2" amino acids 21 to 82 (62 residues), 61.3 bits, see alignment E=2.8e-20 PF00043: GST_C" amino acids 123 to 194 (72 residues), 27.5 bits, see alignment E=7.8e-10

Best Hits

Swiss-Prot: 72% identical to SSPA_SHIFL: Stringent starvation protein A (sspA) from Shigella flexneri

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 100% identity to vch:VC0576)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>CSW01_03060 stringent starvation protein A (Vibrio cholerae E7946 ATCC 55056)
MAVAANKRSVMTLFSSASDMYSHQVRIVLAEKGVSFEVELVDENNLPAELIELNPYKTVP
TLVDRELALYDSKIIMEYLDERFPHPPLMPVYPVARGNSRLMIYRIERNWYSLAEKVVNG
SPEVAENARNKLRNDLLTLGPVFAEFEYFMSEEFSLIDCYLAPLLWRLPVLGIDLIGPGS
KELKVYMNRVFERDSFLASLTEAEREMRLAR