Protein Info for CSW01_03000 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosome maturation factor RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02273: 16S rRNA processing protein RimM" amino acids 16 to 183 (168 residues), 187.1 bits, see alignment E=7.8e-60 PF01782: RimM" amino acids 17 to 96 (80 residues), 93.4 bits, see alignment E=1.2e-30 PF05239: PRC" amino acids 105 to 179 (75 residues), 52.5 bits, see alignment E=6.1e-18 PF24986: PRC_RimM" amino acids 110 to 180 (71 residues), 42.7 bits, see alignment E=5.2e-15

Best Hits

Swiss-Prot: 100% identical to RIMM_VIBCM: Ribosome maturation factor RimM (rimM) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 100% identity to vcm:VCM66_0520)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>CSW01_03000 ribosome maturation factor RimM (Vibrio cholerae E7946 ATCC 55056)
MSMKGKETMSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEY
KVEGWKRHNKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPELSEDEFYWRELFGMQVVT
TNGYDLGVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVDW
DPAF