Protein Info for CSW01_02980 in Vibrio cholerae E7946 ATCC 55056

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 25 to 26 (2 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details PF01595: CNNM" amino acids 13 to 181 (169 residues), 181.9 bits, see alignment E=1.4e-57 PF00571: CBS" amino acids 278 to 326 (49 residues), 25.5 bits, see alignment 2.1e-09 PF03471: CorC_HlyC" amino acids 344 to 418 (75 residues), 64.9 bits, see alignment E=8.1e-22

Best Hits

Swiss-Prot: 64% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A0092)

Predicted SEED Role

"Hemolysins and related proteins containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>CSW01_02980 HlyC/CorC family transporter (Vibrio cholerae E7946 ATCC 55056)
MDDISTGILFALLACLIIISAYFSGSETGMMALNRYRLKHLANSGHKGAKRVEKLLDRPD
RLIGLILIGNNLVNILASAIATIIGMRLYGDLGVAIATGALTLVILVFAEVTPKTLAALY
PERVSYASSVLLTILMKLLSPLVLFVNLMTNGLIRILGISPKHGKGDHLSSEELRTVVNE
AGGLIPRRHQDMLLSILDLEHVTVNDIMIPRNEITGININDDWKSIVRQLVHSPHGRVVL
YRDKIDEVVGILRLREASRFMLEKNDFNKEMLLRAADEIYFIPEGTPLNVQLLKFQRNKE
RIGLIVDEYGEIIGLTTLEDILEEIVGEFTTSMSPSLADEITPQGDGSFLIEGSANIRDI
NKSLKWKLPTDGPRTLNGLILEHLEEIPASHLSVKVAQHKMEILELEENRIKLVKVYPRK
TKVSLV