Protein Info for CSW01_02860 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 63 to 87 (25 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 14 to 272 (259 residues), 334.7 bits, see alignment E=4.3e-104 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 15 to 274 (260 residues), 431 bits, see alignment E=1.7e-133 PF00528: BPD_transp_1" amino acids 81 to 273 (193 residues), 46.1 bits, see alignment E=2.4e-16

Best Hits

Swiss-Prot: 60% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to vco:VC0395_A0067)

MetaCyc: 60% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>CSW01_02860 sulfate ABC transporter permease subunit CysW (Vibrio cholerae E7946 ATCC 55056)
MAHSQPLRVGEKPWVKWSLIALALLLVAVLLLIPLLSIFQQAFANGISAYFSYFNDPDTR
HAIGLTLVVALLTVPINLVFGVLLSWLVTRFEFVGRKFLITLIDIPFAVSPVVAGLLYLL
LYGTSGWLGEWLYERDLQIMFAWPGIVLVTVFVTCPFVARELIPLMQQQGRSDEEAAVIL
GASWWQLFRRVTLPNIKWALIYGVILTNARAVGEFGAVAVVSGNIRGETNTLPLHVQLLY
EDYQSQAAFASASLLAFIALLTLLLKALVEWRQERLQAVEHNEQGTL