Protein Info for CSW01_02855 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfate/thiosulfate ABC transporter permease CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 19 to 43 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 203 to 211 (9 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 9 to 273 (265 residues), 338.8 bits, see alignment E=2.4e-105 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 15 to 278 (264 residues), 411.5 bits, see alignment E=1.7e-127 PF00528: BPD_transp_1" amino acids 82 to 278 (197 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 67% identical to CYST_SALTY: Sulfate transport system permease protein CysT (cysU) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to vcm:VCM66_0497)

MetaCyc: 68% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>CSW01_02855 sulfate/thiosulfate ABC transporter permease CysT (Vibrio cholerae E7946 ATCC 55056)
MGQTLAHSRPRQQRVLPGFALSLGVSLLFVSLILLLPATGLIMQTSNMTFSEYWQVIADP
RVVASYKVTVGSALIASLFNGLFGLLLAWVLVRYTFPGKRILDALVDLPFALPTAVAGIT
LATLYSANGWIGSVLAELGIKVAYTPLGIIVAMAFTSIPFVVRTVQPVLEEISREEEEAG
MTLGASDAAVFWKVILPSLKPALLVGTALSFTRSLGEFGAVIFIAGNMPYISEITSLMIF
VRLQEFDFPAASAIASVVLLTSLLLLLMINLWQGAYLRSIHGR