Protein Info for CSW01_02840 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 TIGR01070: DNA mismatch repair protein MutS" amino acids 15 to 860 (846 residues), 1283.3 bits, see alignment E=0 PF01624: MutS_I" amino acids 16 to 127 (112 residues), 142.7 bits, see alignment E=1.7e-45 PF05188: MutS_II" amino acids 136 to 261 (126 residues), 129.4 bits, see alignment E=3.7e-41 PF05192: MutS_III" amino acids 277 to 566 (290 residues), 183.4 bits, see alignment E=1.9e-57 PF05190: MutS_IV" amino acids 435 to 525 (91 residues), 105.8 bits, see alignment E=3.5e-34 PF00488: MutS_V" amino acids 617 to 804 (188 residues), 294.2 bits, see alignment E=1.4e-91 PF27441: MutS_C" amino acids 830 to 861 (32 residues), 57.3 bits, see alignment (E = 3e-19)

Best Hits

Swiss-Prot: 78% identical to MUTS_ALIFM: DNA mismatch repair protein MutS (mutS) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 81% identity to vsa:VSAL_I0632)

MetaCyc: 73% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (862 amino acids)

>CSW01_02840 DNA mismatch repair protein MutS (Vibrio cholerae E7946 ATCC 55056)
MMKSNASPSESLSHHTPMMQQYLRLKAENPDILLFYRMGDFYELFYDDAKRASELLDISL
TKRGASAGEPIPMAGVPFHAVEGYLAKLVQMGESVAICEQIGDPATSKGPVERKVVRIVT
PGTVTDEALLSERVDNLIAAIYHHNGRFGYATMDITSGRFQLSEPQTEEEMAAELQRTSP
RELLFPEDFSPVHLMASRQGNRRRPIWEFELDTAKQQLNQQFGTRDLVGFGVEQAKLGLC
AAGCLIQYVKDTQRTALPHIRSLTWDRQDQSVILDAATRRNLELTHNLAGGTDNTLAEVL
DHCATPMGSRMLKRWIHQPMRDNATLNQRLDAITELKETALYGELHPVLKQIGDIERILA
RLALRSARPRDLARLRHAMQQLPELHSVMSELKQPHLTELRTHAEPMDELCDLLERAIKE
NPPVVIRDGGVIADGYSAELDEWRDLANGATEFLERLEAEERDRHGIDTLKVGYNNVHGF
YIQVSRGQSHLVPPHYVRRQTLKNAERYIIEELKQHEDKVLNSKSRALALEKQLWEELFD
LLMPHLEQLQQLAASVAQLDVLQNLAERAENLEYCRPTLVQEAGIHIQGGRHPVVERVMN
EPFIANPIELNPQRRMLIITGPNMGGKSTYMRQTALIALMAHIGSYVPAESASIGPLDRI
FTRIGASDDLASGRSTFMVEMTETANILHNATRNSLVLMDEIGRGTSTYDGLSLAWASAE
WLAKEIGAMTLFATHYFELTELPNVLPHLANVHLDAVEHGDGIAFMHAVQEGAASKSYGL
AVAGLAGVPKPVIKNARAKLQQLELLSSQPAETRKPSRVDIANQLSLIPEPSAVEQALAG
VDPDQLTPRQALDMLYQLKKLL