Protein Info for CSW01_02835 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase sigma factor RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 51 to 329 (279 residues), 459.1 bits, see alignment E=6.3e-142 PF00140: Sigma70_r1_2" amino acids 57 to 90 (34 residues), 50.1 bits, see alignment 4.3e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 91 to 318 (228 residues), 124.9 bits, see alignment E=2.4e-40 PF04542: Sigma70_r2" amino acids 95 to 165 (71 residues), 77.3 bits, see alignment E=1.3e-25 PF04539: Sigma70_r3" amino acids 175 to 249 (75 residues), 78.7 bits, see alignment E=5.9e-26 PF04545: Sigma70_r4" amino acids 263 to 316 (54 residues), 62.6 bits, see alignment 3.9e-21

Best Hits

Swiss-Prot: 100% identical to RPOS_VIBCH: RNA polymerase sigma factor RpoS (rpoS) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to vco:VC0395_A0062)

MetaCyc: 72% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>CSW01_02835 RNA polymerase sigma factor RpoS (Vibrio cholerae E7946 ATCC 55056)
MSVSNTVTKVEEFDFEDEALEVLETDAELTSDEELVAVEGASEDVREEFDASAKSLDATQ
MYLSEIGFSPLLTAEEEVLYARRALRGDEAARKRMIESNLRLVVKISRRYSNRGLALLDL
IEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERALMNQTRTIRLPIHVVKELNIYL
RTARELSQRLDHEPTPEEIALELDRPVDDVTKMLRLNERISSVDTPIGGDGDKALLDILP
DSHNADPEFSTQDDDIRESLLNWLDELNPKQKEVLARRFGLLGYEPSTLEEVGREINLTR
ERVRQIQVEGLRRLREILVKQGLNMEALFNVEYDN