Protein Info for CSW01_02560 in Vibrio cholerae E7946 ATCC 55056

Annotation: chromosome initiation inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR03298: transcriptional regulator, ArgP family" amino acids 4 to 295 (292 residues), 345 bits, see alignment E=1.5e-107 PF00126: HTH_1" amino acids 7 to 63 (57 residues), 56.2 bits, see alignment E=2.7e-19 PF03466: LysR_substrate" amino acids 97 to 257 (161 residues), 45.3 bits, see alignment E=7.1e-16

Best Hits

Swiss-Prot: 100% identical to ARGP_VIBCM: HTH-type transcriptional regulator ArgP (argP) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 100% identity to vcj:VCD_001123)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>CSW01_02560 chromosome initiation inhibitor (Vibrio cholerae E7946 ATCC 55056)
MRGLDYRWIEALDSVVSKGSFERAAEQLFISQSAVSQRIKQLEKYLAQPVLIREQPPRPT
LVGKKLLGLYRRVCLIEQELVPELTNQEHVRPVSMSIATNADSLATWLLPALDKVMKSRQ
VELNLVIYGESRTLDKLKNGEVVGAISLEPQPITGCSAEYLGQMEYLCVASPEFYQKYFA
KGVTPRSLIKAPAVSYDQYDELHNKFLWDYFAVPRDKVINHTVGSSEAFVRLALSGAAYC
LIPRLQIISELESGALINMTPDFMLSYPIFWHHWQLETGVLLEISEAITAYAKSVLPQ