Protein Info for CSW01_02555 in Vibrio cholerae E7946 ATCC 55056

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 63 (25 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 128.7 bits, see alignment E=9.8e-42

Best Hits

Swiss-Prot: 47% identical to ARGO_SALHS: Arginine exporter protein ArgO (argO) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to vch:VC0481)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>CSW01_02555 amino acid transporter (Vibrio cholerae E7946 ATCC 55056)
MNWWILLQGFSLGATMIIPIGAQNAYVLNQGIKRHHHLTTAATCGVLDMIFITLGIFGGG
ALISQNTSLLIGVTLAGILFLCGYGFLSLRAALKPPQASESTANPMAAGRKAVIFGAFAV
TVFNPHLYLDTVVILGSIGGQFQGDERISFAIGTILASFVWFFTLSLGAAKLSTTLSKPR
VRQVIDMAVAAMMFIIAFALTKNLYLNHWLN