Protein Info for CSW01_02550 in Vibrio cholerae E7946 ATCC 55056

Annotation: mechanosensitive ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 102 to 131 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 21 to 69 (49 residues), 46 bits, see alignment 8.1e-16 PF21088: MS_channel_1st" amino acids 77 to 118 (42 residues), 34.8 bits, see alignment 2.5e-12 PF00924: MS_channel_2nd" amino acids 120 to 186 (67 residues), 74.6 bits, see alignment E=1.1e-24 PF21082: MS_channel_3rd" amino acids 192 to 274 (83 residues), 67.7 bits, see alignment E=2e-22

Best Hits

Swiss-Prot: 52% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to vco:VC0395_A0032)

MetaCyc: 48% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Protein involved in stability of MscS mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>CSW01_02550 mechanosensitive ion channel protein (Vibrio cholerae E7946 ATCC 55056)
MAGESIGVEVPIVESFNQVNTWLTNNSDLLIQYGVNVISAILILFIGNLVVKGVAGSVAN
VLKKKEMDKAVVDFIHGLVRYTLFIIVLIAALSRIGVQTASVVAVIGAAGLAVGLALQGS
LSNFAAGVLIVAFRPFKSGDYVEIGGVAGSVDSIQIFQTVLKSPDNKMVVVPNSAVIGGA
ITNYSRHETRRVDMVIGVSYKSDLQKTKRVLRETLEKDPRILKDPDMTIGVLTLADSSIN
FVVRPWCKTSDYWAVYFDSMQAIKEALDANGIEIPFPQMDVHLNKIN