Protein Info for CSW01_02525 in Vibrio cholerae E7946 ATCC 55056

Annotation: iron-regulated outer membrane virulence protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 47 to 156 (110 residues), 104.5 bits, see alignment E=6.6e-34 PF00593: TonB_dep_Rec_b-barrel" amino acids 202 to 625 (424 residues), 202.1 bits, see alignment E=4.6e-63 PF14905: OMP_b-brl_3" amino acids 387 to 634 (248 residues), 50 bits, see alignment E=3.8e-17

Best Hits

Swiss-Prot: 100% identical to IRGA_VIBCH: Iron-regulated outer membrane virulence protein (irgA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to vch:VC0475)

Predicted SEED Role

"TonB-dependent receptor; Enterobactin receptor IrgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>CSW01_02525 iron-regulated outer membrane virulence protein (Vibrio cholerae E7946 ATCC 55056)
MSRFNPSPVSLSVTLGLMFSASAFAQDATKTDETMVVTAAGYAQVIQNAPASISVISRED
LESRYYRDVTDALKSVPGVTVTGGGDTTDISIRGMGSNYTLILVDGKRQTSRQTRPNSDG
PGIEQGWLPPLQAIERIEVIRGPMSTLYGSDAIGGVINIITRKDQQQWSGNVQLSTVVQE
NRASGDEQSANFFVTGPLSDALSLQVYGQTTQRDEDEIEHGYGDKSLRSLTSKLNYQLNP
DHQLQLEAGVSAQDRENNVGKSAQSSGCRGTCSNTDNQYRRNHVAVSHQGDWQDVGQSDT
YLQYEENTNKSREMSIDNTVFKSTLVAPIGEHMLSFGVEGKHESLEDKTSNKISSRTHIS
NTQWAGFIEDEWALAEQFRLTFGGRLDHDKNYGSHFSPRVYGVWNLDPLWTVKGGVSTGF
RAPQLREVTPDWGQVSGGGNIYGNPDLKPETSINKELSLMYSTGSGLAASLTAFHNDFKD
KITRVACPANICTAGPNQWGAAPTYRVNIDEAETYGAEATLSLPITESVELSSSYTYTHS
EQKSGNFAGRPLLQLPKHLFNANLSWQTTDRLNSWANLNYRGKEMQPEGGASNDDFIAPS
YTFIDTGVTYALTDTATIKAAVYNLFDQEVNYAEYGYVEDGRRYWLGLDIAF