Protein Info for CSW01_02415 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA (guanosine(46)-N7)-methyltransferase TrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 47 to 238 (192 residues), 228.2 bits, see alignment E=2.8e-72 PF02390: Methyltransf_4" amino acids 62 to 232 (171 residues), 204 bits, see alignment E=6.3e-65

Best Hits

Swiss-Prot: 100% identical to TRMB_VIBCH: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 99% identity to vco:VC0395_A0005)

MetaCyc: 68% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>CSW01_02415 tRNA (guanosine(46)-N7)-methyltransferase TrmB (Vibrio cholerae E7946 ATCC 55056)
MSEVITQEYTEDGKVLRRIRSFVRREGRLTKGQEAAMKECWPTMGIDYQPELLDWQQVFG
NDNPVVLEIGFGMGASLVEMAKNAPEKNFLGIEVHSPGVGACLASAREAGVTNLRVMCHD
AVEVFAHMIPDNSLHTLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLMIGSGVFHMATD
WENYAEHMVEVMNQAPGFANLATDGDYVPRPDERPLTKFEQRGHRLGHGVWDIKYQRTA