Protein Info for CSW01_02410 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR01084: A/G-specific adenine glycosylase" amino acids 4 to 266 (263 residues), 438.6 bits, see alignment E=5.1e-136 PF00730: HhH-GPD" amino acids 34 to 165 (132 residues), 86.3 bits, see alignment E=3.5e-28 PF00633: HHH" amino acids 97 to 125 (29 residues), 29 bits, see alignment (E = 1.3e-10) PF14815: NUDIX_4" amino acids 231 to 343 (113 residues), 81.3 bits, see alignment E=9.1e-27

Best Hits

Swiss-Prot: 60% identical to MUTY_ECOLI: Adenine DNA glycosylase (mutY) from Escherichia coli (strain K12)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to vcj:VCD_001155)

MetaCyc: 60% identical to adenine DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2661 [EC: 3.2.2.31]

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>CSW01_02410 adenine DNA glycosylase (Vibrio cholerae E7946 ATCC 55056)
MTPFAQAILTWYDAYGRKNLPWQQNKNAYRVWLSEIMLQQTQVATVIPYFERFLERFPTV
HALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGVGRSTA
AAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDVDKYNQ
AMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDKPVKATWFVMLYHDN
AVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTFSHYHLD
ITPILLQLSRKPDIVMEGSKGLWYNLSHPDEIGLAAPVKQLLHTLPFDIDSHI