Protein Info for CSW01_02400 in Vibrio cholerae E7946 ATCC 55056

Annotation: lytic murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF11873: Mltc_N" amino acids 46 to 206 (161 residues), 242.2 bits, see alignment E=2.2e-76 PF01464: SLT" amino acids 211 to 335 (125 residues), 100.3 bits, see alignment E=5.2e-33

Best Hits

Swiss-Prot: 53% identical to MLTC_PHOLL: Membrane-bound lytic murein transglycosylase C (mltC) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K08306, membrane-bound lytic murein transglycosylase C [EC: 3.2.1.-] (inferred from 100% identity to vco:VC0395_A0001)

MetaCyc: 52% identical to membrane-bound lytic murein transglycosylase C (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>CSW01_02400 lytic murein transglycosylase (Vibrio cholerae E7946 ATCC 55056)
MRKLVLCITALLLSGCSREFIEKIYDVDYEPTNRFAKNLAELPGQFQKDTAALDALINSF
SGNIEKRWGRRELKIAGKNNYVKYIDNYLSRSEVNFTEGRIIVETVSPIDPKAHLRNAII
TTLLTPDDPAHVDLFSSKDIELKGQPFLYQQVLDQDGQPIQWSWRANRYADYLIANHLKV
KQVDFKKAYYVEIPMVKDQIDIRGYKYASIVRKASRKYDIPEDLIYAIIKTESSFNPYAV
SWANAYGLMQVVPKTAGRDVFKLVKNRSGEPSPEYLFNPENNIDTGTAYFYILKNRYLKE
VRHPTSLEYSMISAYNGGTGGVLSTFSSDRQRAMRDLNALQPNQVYWALTKKHPNAEARR
YLEKVTKFKKEFNAG