Protein Info for CSW01_02265 in Vibrio cholerae E7946 ATCC 55056

Annotation: arginine repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF01316: Arg_repressor" amino acids 7 to 74 (68 residues), 78.7 bits, see alignment E=2.3e-26 TIGR01529: arginine repressor" amino acids 10 to 151 (142 residues), 140.1 bits, see alignment E=2.6e-45 PF02863: Arg_repressor_C" amino acids 82 to 146 (65 residues), 70.8 bits, see alignment E=6.9e-24

Best Hits

Swiss-Prot: 100% identical to ARGR_VIBCH: Arginine repressor (argR) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 100% identity to vch:VC0431)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>CSW01_02265 arginine repressor (Vibrio cholerae E7946 ATCC 55056)
MRNVDKQDNLVRAFKALLKEERFGSQGDIVEALKNEGFDNINQSKVSRMLTKFGAVRTRN
AKMEMVYCLPAELGVPTASSSLRELVLDVDYNNALVVIRTGPGAAQLIARLLDSLGKSEG
ILGVVAGDDTIFITPTLDVPVKELFHSVCELFEYAG