Protein Info for CSW01_02225 in Vibrio cholerae E7946 ATCC 55056

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01078: arginine deiminase
  • amino acids 4 to 407 (404 residues), 595.7 bits, E=2e-183
• PF02274: ADI
  • amino acids 34 to 404 (371 residues), 501.4 bits, E=1.8e-154
• PF19420: DDAH_eukar
  • amino acids 150 to 276 (127 residues), 23.8 bits, E=2.6e-09

Best Hits

Swiss-Prot: 100% identical to ARCA_VIBC3: Arginine deiminase (arcA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 100% identity to vcj:VCD_001199)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (3/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Protein Sequence (407 amino acids)

>CSW01_02225 arginine deiminase (Vibrio cholerae E7946 ATCC 55056)
MNRLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLAVEAAGVEHDAFANTLRT
QDVEVLLLHDLLEETLAIPEARQWLLNTQISDFRFGPTFARELRHALNHLDDHHLTTLLL
GGLAFSELHLESDSMLPKMRQPLDFVIEPLPNHLFTRDTSCWVYGGVSLNPMMKPARQRE
TNHLRAIYRWHPIFAQHPFIHYFGIDDLHYDNANIEGGDVLVIGKGAVLIGMSERTSPQG
VENLAAALFKHGQASKVIAINLPKHRSCMHLDTVMTHMDVDTFSVYPEVMRKDLPTWRLT
PKGNNGDMRVEQVPSYLHAIEQALGVDYLKIITTGGNSYEAEREQWNDANNVLTVKPGVV
IGYERNVYTNEKYDKAGIKVLTIPGNELGRGRGGARCMSCPIERDGI