Protein Info for CSW01_02220 in Vibrio cholerae E7946 ATCC 55056

Annotation: metalloprotease TldD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF01523: PmbA_TldD_1st" amino acids 36 to 100 (65 residues), 48.2 bits, see alignment E=1.5e-16 PF19290: PmbA_TldD_2nd" amino acids 125 to 238 (114 residues), 71.6 bits, see alignment E=1.1e-23 PF19289: PmbA_TldD_3rd" amino acids 246 to 479 (234 residues), 228 bits, see alignment E=1.2e-71

Best Hits

Swiss-Prot: 68% identical to TLDD_SHIFL: Metalloprotease TldD homolog (tldD) from Shigella flexneri

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to vco:VC0395_A2841)

MetaCyc: 68% identical to metalloprotease subunit TldD (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>CSW01_02220 metalloprotease TldD (Vibrio cholerae E7946 ATCC 55056)
MTMNQIETALLAPAGLTEQDIADTLSSIATRQIDYADIYFQSSWHESLVLEDSIIKDGSF
NIDCGVGVRAVSGEKTGFAYSDQIQLEGLKQSAIAARGIAQQGQNLTVQAFKRAQHPAFY
GAHNPLESWEKQQKTELLKQLDAYIRTKEPLITEVSVSLSGVHEQILVAATDGTYAGDIR
PLVRLSISVLAQKGDRRERGSAGGGGRFGYDYFLQEEAGQKIAFSFADEAIRQALVNLEA
VAAPAGTMPVVLGSGWPGVLLHEAVGHGLEGDFNRKGSSVFAGKVGKKVTSDLCTIVDDG
TLKDLRGSLNVDDEGVSGQYNVLIEKGILKGYIQDKLNARLMGVAPTGNGRRESYAHLPM
PRMTNTYMLPGEHTPEEIIASVKKGIYAPNFGGGQVDITSGKFVFSASEAYLIENGKITR
PIKGATLIGSGIEAMQQVSMVGNDLALDRGVGVCGKAGQSVPVGVGQPTLKLDALTVGGT
E