Protein Info for CSW01_02200 in Vibrio cholerae E7946 ATCC 55056

Annotation: septum formation inhibitor Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR00172: septum formation protein Maf" amino acids 23 to 202 (180 residues), 189.5 bits, see alignment E=2.1e-60 PF02545: Maf" amino acids 23 to 205 (183 residues), 217.4 bits, see alignment E=6.6e-69

Best Hits

Swiss-Prot: 100% identical to NTPPA_VIBCH: dTTP/UTP pyrophosphatase (VC_0418) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to vco:VC0395_A2837)

MetaCyc: 56% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>CSW01_02200 septum formation inhibitor Maf (Vibrio cholerae E7946 ATCC 55056)
MAVDVFITAPSSTPLACEMTISKLVLASGSPRRRELLAQMGYQFEVVVPNVEEKRAAAES
PAQYVERLSRDKALAGAALVAAEAVVIGSDTIVVKDQQVLEKPRDFADAKRMLLKLSGSQ
HQVMTGVSVTCRGITHSVVVTTEVWFKTLSEQEIEAYWQSGEPCDKAGSYGIQGLGGRFV
TRIEGSYHAVVGLPLYETDQLLHKF