Protein Info for CSW01_02195 in Vibrio cholerae E7946 ATCC 55056

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 69 to 94 (26 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details PF04093: MreD" amino acids 6 to 155 (150 residues), 165.8 bits, see alignment E=4.5e-53 TIGR03426: rod shape-determining protein MreD" amino acids 9 to 154 (146 residues), 123 bits, see alignment E=5.4e-40

Best Hits

Swiss-Prot: 54% identical to MRED_ECO57: Rod shape-determining protein MreD (mreD) from Escherichia coli O157:H7

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 100% identity to vcj:VCD_001205)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>CSW01_02195 rod shape-determining protein MreD (Vibrio cholerae E7946 ATCC 55056)
MLSSDIKGRMVILASFLLALILQTIPWPGTLDLFRPPWLLLVCCYWVLALPHRVNVGSAL
VMGLLWDLLLGSTLGIRGMMMSIIIYLVAMNFLVLRNMALWQQAIVIGLLSMGLEVLIFC
GEYLIQNVTFNPLSLWSGVIACILWPWMFLLLRRVRRHWHVK