Protein Info for CSW01_02175 in Vibrio cholerae E7946 ATCC 55056

Annotation: MSHA biogenesis protein MshP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details

Best Hits

KEGG orthology group: K12286, MSHA biogenesis protein MshP (inferred from 99% identity to vcm:VCM66_0398)

Predicted SEED Role

"MSHA biogenesis protein MshP" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>CSW01_02175 MSHA biogenesis protein MshP (Vibrio cholerae E7946 ATCC 55056)
MIMMLWSTTHRKQQGNALILVVFIIVVVGFVALVANRNQARSSQQLVSMVLGTRAEMAAR
SALNIELSRFYQSNKSAGSCYTTSPQSMDFAGEGLAQCEATVSCLSLGALDNGQAVYQLS
ATGRCQVGDWSLQRIIEVGVKSE