Protein Info for CSW01_02100 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNase E specificity factor CsrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details PF17157: GAPES4" amino acids 42 to 137 (96 residues), 109.3 bits, see alignment E=1.6e-35 PF00990: GGDEF" amino acids 232 to 384 (153 residues), 55.9 bits, see alignment E=6.8e-19 PF00563: EAL" amino acids 432 to 638 (207 residues), 154.7 bits, see alignment E=4.1e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001225)

Predicted SEED Role

"MSHA biogenesis protein MshH" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (673 amino acids)

>CSW01_02100 RNase E specificity factor CsrD (Vibrio cholerae E7946 ATCC 55056)
MAQMRYTPTLKLSTRLVAFVTMTVISAMFILFLGGTLSFQRLGQEYLNHYLQGIVEVVDK
EMEDPDAAYSMQRWMPKMLQASGIIEMQLTSEAGPIYRFKDTTNTIEASRLHQVALPLKR
NPGYVMHFKAVPPYLNYNYSLQAMWSTTLAVLLIVFFLIRGLKWLKEQLLGSELLEERGR
MILAGRVEQHAKGDPREWPFTASEALDRLIEELQDARQERSRFDTFIRSQTFLDQLTGTA
NRVLYDSKLESALLESGAHGGVMMLRVDDLESAREESPKRTLDEFIIEVGECLSNIVQRY
PDAILSRYYEDVFALFIPHQGSKDIAQVATQAIKLIERINPPEPLPEDNWFHIGVTMYQE
GERRGRIIDEMETALKSAQLQGVNAWSRFQKPKQLQEDRGSVRWRTLFEQVLRPEEILLY
RQACYRISANGEREFLHYELFARIQDPQQGILKASRFSSALETVGYEAMLDRAVFSSVVS
FLKRSELVEPLSVNLHVVPFNDKRYARWIRNELMQMPFSLRTALSFEFSEAHLVNHLDYM
RPIIRMLAGLGCKIVVGQAGRTIVSTHYIKDLKVNYLKLHRSLIKKIDQRHENQLFVRSL
VGVCGGTQAEVVAVGVETTQEWQTLQMLGVSGVQGRLFDEEQQMLPPLPPEPLKRPPRLS
VKPIGKRNRWRTK