Protein Info for CSW01_02055 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 295 to 313 (19 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 22 to 416 (395 residues), 194.4 bits, see alignment E=1.4e-61

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 100% identity to vco:VC0395_A2807)

Predicted SEED Role

"Na+/H+ antiporter NhaP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>CSW01_02055 sodium:proton antiporter (Vibrio cholerae E7946 ATCC 55056)
MSVYYTLCFLSAAAMLIAFINSKISRMQTTIAITAGSMMLSLLILIAGQNDWFHLNQIAT
ETVTSINFENFLLKGILGFLLFAGGLGIKLPNLKDQKWEITVLALGATLFSTFFIGFTLY
GFCQLIGIQFDLVYCLLFGALISPTDPIAVLAIVKKLKAPKRISTQIEGESLFNDGFGLV
IFVTIFTIAFGHETPTVGSVTLLFIQEAIGGIVYGFLLGLLFHYLISATDDHSMELLLTI
GIPTAGYAFADVIHVSGPLAMVVSGIMIGNWTRFIGFSKESEEHLDHFWELVDEFLNGVL
FLLIGMSMLLFEFHQEDWILMAFAVPLVLCGRYLSVFVSYIGFKRYRSYNPWSIRILTWG
GLRGGLALAMALSIPSGIMVIPEKLIDVKELILVMTYAVVVFSILVQGSTITPMIEKAKK
AEKALQAERNTDNQSPMPQQEQQH