Protein Info for CSW01_02020 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 24 to 245 (222 residues), 304.8 bits, E=4.6e-95
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 36 to 246 (211 residues), 285.8 bits, E=2.4e-89
• PF01507: PAPS_reduct
  • amino acids 51 to 223 (173 residues), 194.2 bits, E=9.9e-62

Best Hits

Swiss-Prot: 100% identical to CYSH_VIBC3: Phosphoadenosine phosphosulfate reductase (cysH) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to vcj:VCD_001237)

MetaCyc: 70% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (5/10 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (253 amino acids)

>CSW01_02020 phosphoadenosine phosphosulfate reductase (Vibrio cholerae E7946 ATCC 55056)
MPNRTVPTLEELLTLNKVQQTLRLTEVNQHLESLTAQERVVWGLENLQGNHALSSSFGIQ
AAVMLHLLTSVKSDIPVVLTDTGYLFPETYQFIDELTERLNLNLKVYSAPVSAAWQEARY
GKLWEQGVEGIERYNQINKVEPMRRALDELNIGTWFSGLRREQSQSRASLPILSVQNGVF
KFLPVIDWTNKEVHYYLKDNDLPYHPLWEQGYLSVGDTHTTQKWQPGMNEEQTRFFGLKR
ECGLHEDHNDTHQ