Protein Info for CSW01_01930 in Vibrio cholerae E7946 ATCC 55056

Annotation: primosomal replication protein N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF22657: SSB_1" amino acids 3 to 95 (93 residues), 72.8 bits, see alignment E=2.2e-24 PF00436: SSB" amino acids 3 to 88 (86 residues), 40.9 bits, see alignment E=1.7e-14 TIGR04418: primosomal replication protein PriB" amino acids 3 to 100 (98 residues), 108.8 bits, see alignment E=5.8e-36

Best Hits

Swiss-Prot: 100% identical to PRIB_VIBCH: Primosomal replication protein N (priB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02686, primosomal replication protein N (inferred from 100% identity to vcj:VCD_001257)

MetaCyc: 49% identical to primosomal replication protein N (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Primosomal replication protein N" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>CSW01_01930 primosomal replication protein N (Vibrio cholerae E7946 ATCC 55056)
MTNRIELSGVVAKALVRSQSPSGVKHCHFWLEHRSTMVEADLPRQVFCRLPVVVSGARSE
ALTQNLVQGSSILVSGFLAYQTSRNGVGKLVLHADKISQI