Protein Info for CSW01_01905 in Vibrio cholerae E7946 ATCC 55056

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 TIGR00484: translation elongation factor G" amino acids 1 to 696 (696 residues), 1214 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 212.5 bits, see alignment E=1.3e-66 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 118.8 bits, see alignment E=2e-38 PF22042: EF-G_D2" amino acids 314 to 397 (84 residues), 62.9 bits, see alignment E=7.5e-21 PF03144: GTP_EFTU_D2" amino acids 329 to 396 (68 residues), 68.7 bits, see alignment E=1.5e-22 PF14492: EFG_III" amino acids 409 to 483 (75 residues), 114.6 bits, see alignment E=5.1e-37 PF03764: EFG_IV" amino acids 484 to 603 (120 residues), 164.8 bits, see alignment E=2.1e-52 PF00679: EFG_C" amino acids 605 to 691 (87 residues), 107.2 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 100% identical to EFG1_VIBCH: Elongation factor G 1 (fusA1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02355, elongation factor G (inferred from 87% identity to vsa:VSAL_I0312)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (698 amino acids)

>CSW01_01905 elongation factor G (Vibrio cholerae E7946 ATCC 55056)
MARKTPIERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHDGAATMDWMVQEQERG
ITITSAATTTFWRGMEAQFQEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVE
PQSETVWRQADKYGVPRMVFVNKMDRAGADFLRVVGQIKHRLGANPVPIQLNIGAEEEFK
GVIDLIKMKAINWNEADQGMSFTYEEIPADMLELAQEWRNHLVEAAAEASEELMEKYLED
GELSEVEIKQALRQRTINNEIVLAACGSAFKNKGVQAVLDAVIEFLPSPTDVPAIKGIDD
RENSVERHADDNEPFSSLAFKIATDPFVGSLTFIRVYSGVVNSGDAVYNSVKQKKERFGR
IVQMHANKRDEIKEIRAGDIAAAIGLKDVTTGDTLCDPNHVVILERMEFPEPVIQIAVEP
RSKADQEKMGIALGKLAAEDPSFRVETDAETGQTLISGMGELHLDIIVDRMKREFGVDCN
VGKPQVAYRETIRGKSEVEGKFVRQSGGRGQYGHVWLKIEPAEPGQGFVFVDAIAGGVIP
KEFINPVAKGIEEQMNNGVLAGYPVLDVKATLFDGSFHDVDSSEMAFKIAGSMAFKKGAL
EAQPVLLEPLMKVEITTPEDWMGDVVGDLNRRRGIIEGMDEGPAGLKIIHAKVPLSEMFG
YATDLRSATQGRASYSMEFAEYADVPKNIADAIIAEHG