Protein Info for CSW01_01885 in Vibrio cholerae E7946 ATCC 55056

Annotation: sulfurtransferase TusC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR03010: sulfur relay protein TusC/DsrF" amino acids 3 to 118 (116 residues), 156.4 bits, see alignment E=1.3e-50 PF02635: DsrE" amino acids 3 to 118 (116 residues), 110.9 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 100% identical to TUSC_VIBCH: Protein TusC homolog (tusC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07236, tRNA 2-thiouridine synthesizing protein C (inferred from 100% identity to vcm:VCM66_0341)

MetaCyc: 50% identical to sulfurtransferase complex subunit TusC (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusC"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>CSW01_01885 sulfurtransferase TusC (Vibrio cholerae E7946 ATCC 55056)
MNKVAWVFHTPPHGSTAGREGLDAILATSAYSEEQALFFVGEGVLQLVNHQHPESILSRD
YISAFKLLDLYDIEARYVCQQSLVSWGLSEQDLLIEVEVVDAQALAQLLHHYDQLLTF