Protein Info for CSW01_01830 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00174: tRNA dimethylallyltransferase" amino acids 9 to 295 (287 residues), 388.5 bits, see alignment E=9e-121 PF01715: IPPT" amino acids 42 to 284 (243 residues), 307.5 bits, see alignment E=7.4e-96

Best Hits

Swiss-Prot: 100% identical to MIAA_VIBC3: tRNA dimethylallyltransferase (miaA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to vcj:VCD_001277)

MetaCyc: 72% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>CSW01_01830 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA (Vibrio cholerae E7946 ATCC 55056)
MTQKLPLALFLMGPTASGKTDLAIRLRQKYPVEIISVDSALIYRGMDIGTAKPDAQELAL
APHRLIDILDPSEAYSAADFRRDALKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPA
ADPVIRQQIELEAEKLGWQALHDQLQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTE
LTQTKGEAIPYRVLQFAIAPKERAELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLP
SIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLAKRQITWLRSWDDLTWLDSENVDQAV
ETLSNAIASNEISCV