Protein Info for CSW01_01825 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 310 (310 residues), 343.2 bits, see alignment E=9.6e-107 PF02518: HATPase_c" amino acids 21 to 77 (57 residues), 31.2 bits, see alignment 5.2e-11 PF13589: HATPase_c_3" amino acids 24 to 115 (92 residues), 51.7 bits, see alignment E=1.9e-17 PF01119: DNA_mis_repair" amino acids 213 to 329 (117 residues), 135.5 bits, see alignment E=1.4e-43 PF08676: MutL_C" amino acids 475 to 610 (136 residues), 108.8 bits, see alignment E=3.7e-35

Best Hits

Swiss-Prot: 100% identical to MUTL_VIBCH: DNA mismatch repair protein MutL (mutL) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to vcj:VCD_001278)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>CSW01_01825 DNA mismatch repair protein MutL (Vibrio cholerae E7946 ATCC 55056)
MTIRILPARLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDLEKGGAKLIRIRDNG
SGIDKDELGLALSRHATSKIHTLDDLEAIMSLGFRGEALASISSVSRLTLTSRTVAQEEA
WSAYSEGRDMAVKLQPAAHPVGTTVEVLDLFFNTPARRKFLRTEKTEFTHIDELLKRIAL
SRFDVSFTLRHNGKIVRQYRAATTLPQQEKRLAAVCGNPFVQHMLRIELEHQGLKLHGWI
TTPEGARQQSDLQYCYVNGRMMRDKLINHAIRQSYETSLRVDQFATYVLFIELDPHQVDV
NVHPAKHEVRFHQARLVHDFIYQALSSALVQGAQVMAPTINEGAFHLPHCAEEVNPPVVP
MIDTTQQERVWQAVQNTPDYPRKAPRDNDRDESDNPQVRERAVSNPWVASPKTASTGKER
YGSASVSKKEAAVYQTLMQTPDLSDEEPSTASTIVSSIEAVKANIAIEKLGKAIQVVAGQ
YLLMSSPQGCVLISLYQAQQLKLRGLLNAQHGALKAQPLLVPLALKLNESEWQVAQRHSS
ALLQLGIELKSRTNHSIMVMAVPQPLRQQNLQQLLPDLLSYAASCSESQALSHQALADWL
TQRIVVEKRDYTLAEAIGLIAELEQLWQGNLPLQDPHFITLVDFSASITALHS