Protein Info for CSW01_01755 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 48 to 283 (236 residues), 293.9 bits, E=3.7e-92
• PF02666: PS_Dcarbxylase
  • amino acids 62 to 281 (220 residues), 219.6 bits, E=1.7e-69

Best Hits

Swiss-Prot: 100% identical to PSD_VIBCM: Phosphatidylserine decarboxylase proenzyme (psd) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to vcj:VCD_001285)

MetaCyc: 60% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (285 amino acids)

>CSW01_01755 phosphatidylserine decarboxylase proenzyme (Vibrio cholerae E7946 ATCC 55056)
MDKIKVGLQYWIPQHALTRLVGKLASARAGSLTTAIIRWFIKQYNVNMDEALHSDPTHFK
TFNEFFVRELKAGVRPIAEGEKVITHPADACVSQFGAIEYGKLIQAKGHTYSAQELLGGD
AKLAEEFRDGDFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDLFSVNPLTAENVPNLFAR
NERVVCIFDTEFGPMAQVLVGATIVGSIELVWAGTVTPPRGNTVYRWDYPANGNQAVVLK
KGEEMGRFKLGSTVINLFAKQAIRFDDSMALGAPTRMGEPYAHQA