Protein Info for CSW01_01630 in Vibrio cholerae E7946 ATCC 55056

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 19 to 342 (324 residues), 315.1 bits, see alignment E=2.2e-98 PF01565: FAD_binding_4" amino acids 32 to 163 (132 residues), 79.5 bits, see alignment E=2e-26 PF02873: MurB_C" amino acids 219 to 341 (123 residues), 107.4 bits, see alignment E=3.6e-35

Best Hits

Swiss-Prot: 100% identical to MURB_VIBCH: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to vco:VC0395_A2716)

MetaCyc: 51% identical to UDP-N-acetylenolpyruvoylglucosamine reductase (Escherichia coli K-12 substr. MG1655)
UDPNACETYLMURAMATEDEHYDROG-RXN [EC: 1.3.1.98]

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158 or 1.3.1.98

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>CSW01_01630 UDP-N-acetylmuramate dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MASLSYPKTTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLII
GKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLEN
LALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQ
LYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNA
GSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQ
ALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETNLKQWMSEQA