Protein Info for CSW01_01530 in Vibrio cholerae E7946 ATCC 55056

Annotation: cyclic nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 transmembrane" amino acids 254 to 275 (22 residues), see Phobius details PF00027: cNMP_binding" amino acids 31 to 113 (83 residues), 40.2 bits, see alignment E=5.5e-14 PF00571: CBS" amino acids 222 to 275 (54 residues), 19.6 bits, see alignment 1.9e-07 PF03445: DUF294" amino acids 301 to 431 (131 residues), 142.1 bits, see alignment E=2.2e-45 PF10335: DUF294_C" amino acids 470 to 603 (134 residues), 137.9 bits, see alignment E=4.4e-44

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to vcm:VCM66_0285)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (607 amino acids)

>CSW01_01530 cyclic nucleotide-binding protein (Vibrio cholerae E7946 ATCC 55056)
MPDKFNMQSPPFNRLTAEQQHQLRSALDVAYFRQRDVLIDAQHPVTHLHILIKGTVEERS
PDGKEVFAHYANDDLFDVRAMFEELSKHQYMALEDTLSYLLPKSIFLQLYEQNGEFAAYF
DNNLAKRQELIEAAAQQKNIAEFILTKVDRSIYHPPFILSPEQPIHSVTQQLKERGIDAA
LVELHPSDPRLAHNHAHPYAIVTRTNMLHAVMLEGRPLDTPVGEIATFPVLHVDEGDFLF
NAMVMMTRQRIKRVMVCLGNQAVGLLSLIQILSAFSTHSHVLTLAIARAASIDELALAAN
KQRELVESLMSRGVRTRFVMELIAAVNEQIIEKAFELVVPPALHDQCCLVVLGSEGRGEQ
ILKTDQDNALIIQDGLEWHQCQPIMETLTHTLLQLGYPLCPGKVMVNNPKWVRSQSDWKR
TLTDWVKAARPEQVMDIAIFADAHAVAGNRALLAPVKAHLQHLMAGQELILAEFTRPALN
FSVPLTLFGNVKSSKQGIDIKQGGIFPIVHGVRALSLEHAIDANNTFDRIEALVKKRVLE
QETGDNLSEAFKLFLKLRLAQQLGNQHSTNQLDFKQLDRTERDLLRHSLHVVKKFKQWLG
YHYQIRD